PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072165.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 233aa    MW: 25514.4 Da    PI: 8.8819
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072165.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.98.5e-4410108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPv+G+v+ i+ lq+q+++l++el+
  XP_011072165.1  10 PCAACKFLRRKCIPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVHGCVSAISFLQRQVDRLQKELD 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_011072165.1 105 AANA 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.4949110IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4210107IPR004883Lateral organ boundaries, LOB
CDDcd092727.41E-32150217No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CIPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNSL AYEAEARVRD PVHGCVSAIS FLQRQVDRLQ KELDAANADL IRFACNDIQA  120
AGLQPPPAAP QALASTHMVP AQPRTVGGWG GKPQADVILH SDSQSAIHLA KNPAFHSRTK  180
HIEIKYHFIR QLLEKKALQL EKIQGEKNPA DMLTKAVAMA KLKLCTASTG LDD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072165.11e-174PREDICTED: protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0A0LU814e-81A0A0A0LU81_CUCSA; Uncharacterized protein
STRINGGLYMA04G36080.13e-80(Glycine max)
STRINGGLYMA17G09380.23e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.45e-73LBD family protein